SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158333884|ref|YP_001515056.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333884|ref|YP_001515056.1|
Domain Number 1 Region: 7-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.96e-68
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000674
Further Details:      
 
Domain Number 2 Region: 187-321
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.11e-39
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158333884|ref|YP_001515056.1|
Sequence length 327
Comment pyruvate dehydrogenase E1 component beta subunit [Acaryochloris marina MBIC11017]
Sequence
MAEVLLFNALRDAIDEEMANDNTVMVMGEDVGHYGGSYKVTKGLYDKYGELRVLDTPIAE
NSFTGMAVGAAMTGLKPIIEGMNMGFLLLAFNQIANNAGMLRYTSGGNFKIPMVIRGPGG
VGRQLGAEHSQRLEAYFQAVPGLKIVACSTPYNAKGLLKAAIRDPNPVLFFEHVLLYNLK
EELPDQEYVLPLDKAEVVRSGKDVTILTYSRMRHHVVQAAKTLTEQGYDPEIIDLISLKP
LDFDTIGASIRKTHRVIVVEECMRTGGVGAEIIASINDRFFDELDAPVVRLSSQDIPTPY
NGMLESLTIVQPPQIVEAVQQITALQV
Download sequence
Identical sequences B0CEA8
gi|158333884|ref|YP_001515056.1| WP_010469156.1.53659 WP_010469156.1.67183 329726.AM1_0696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]