SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158334076|ref|YP_001515248.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334076|ref|YP_001515248.1|
Domain Number 1 Region: 4-79
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 6.02e-21
Family F1F0 ATP synthase subunit C 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158334076|ref|YP_001515248.1|
Sequence length 81
Comment F0F1 ATP synthase subunit C [Acaryochloris marina MBIC11017]
Sequence
MDPLVAAASVLAAALGIGISTIGPALAQGNAAGKAVEGIARQPEAEGKIRGTLLLCLAFM
ESLTIYGLVIALVLLFANPFA
Download sequence
Identical sequences B0BZK8
329726.AM1_0892 WP_010468088.1.53659 WP_010468088.1.67183 gi|158334076|ref|YP_001515248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]