SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158334289|ref|YP_001515461.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334289|ref|YP_001515461.1|
Domain Number 1 Region: 6-185
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.57e-38
Family Pyruvate oxidase and decarboxylase Pyr module 0.0026
Further Details:      
 
Domain Number 2 Region: 400-572
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.32e-20
Family Pyruvate oxidase and decarboxylase PP module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158334289|ref|YP_001515461.1|
Sequence length 586
Comment 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [Acaryochloris marina MBIC11017]
Sequence
MTLDFRNVNMLWSSIIAETLSRLGLTTAIICPGSRSGPLAVAFAQHPDIEAIPVLDERSA
AFFGLGIARRKGLPVVLVCTSGTAGANFYPAVIEAEASGVPLLLLTADRPPELRHCQAGQ
AIDQVKLYGHYPRWQVELALPSTHPEMLAYLRQTCVYAWEQSQRPVPGPVHLNIPFRDPL
APISDLETESLAATFDIDQFFAAVHPLPSVQISLDLQTTNVYLDQWMSCDRGLIIAGPAQ
PDTPEHYCLAIAQLAHILGWPVLAEGLSPLRNWADRNSYLISTYDLILRNPTIASQLQPQ
QVISIGALPTSKVLRVWLTQSRAQTWVVDVSDHNMDPLHGLSIPVRISVEGLITSIPAAK
KEHCQPLTAYAKSWLNANHSVRTLINRAMQKQSELIESKIAWLLSQILPPRTPLFIANSM
PVRDIEYFWQPGTLHIQPYFNRGANGIDGTLSTALGMSHRQQSSVLLTGDLALLHDTNGF
LLQDYWQGHLTIIVVNNGGGGIFQMLPISAFDPPFERFFRTPQQVQLKHLAATYQAKWTL
IQSWAHLQQALNPLPESGLHILEISCDCQNDTQWRRIFFKECVKSL
Download sequence
Identical sequences B0C1Y1
329726.AM1_1108 WP_012161701.1.67183 gi|158334289|ref|YP_001515461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]