SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158334427|ref|YP_001515599.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334427|ref|YP_001515599.1|
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily L28p-like 9.81e-25
Family Ribosomal protein L31p 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158334427|ref|YP_001515599.1|
Sequence length 85
Comment 50S ribosomal protein L31 [Acaryochloris marina MBIC11017]
Sequence
MAKPDIHPKWYPEAKVYCDGEVVMTVGSTQEELHVDVWSGNHPFFTGTQKIIDTEGRVER
FMRKYGMSESQGAGGKGNAKKKDEK
Download sequence
Identical sequences B0C425
WP_010480591.1.53659 WP_010480591.1.67183 329726.AM1_1248 gi|158334427|ref|YP_001515599.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]