SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158334447|ref|YP_001515619.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334447|ref|YP_001515619.1|
Domain Number 1 Region: 33-137
Classification Level Classification E-value
Superfamily NTF2-like 9.64e-34
Family SEC-C associated NTF2-like domain 0.0014
Further Details:      
 
Domain Number 2 Region: 144-163
Classification Level Classification E-value
Superfamily Sec-C motif 0.000000687
Family Sec-C motif 0.0025
Further Details:      
 
Weak hits

Sequence:  gi|158334447|ref|YP_001515619.1|
Domain Number - Region: 11-28
Classification Level Classification E-value
Superfamily Sec-C motif 0.000196
Family Sec-C motif 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158334447|ref|YP_001515619.1|
Sequence length 166
Comment SecC motif-containing protein [Acaryochloris marina MBIC11017]
Sequence
MLISGDRNTLMPCPCGSQKLFNQCCGVYLQGSRPAPTAETLMRSRYVAYCLKNIDYLFNT
EHPNHRQPNSRQLIAATANNLTWLGLTVLATKAGQPEDKTGIVEFFAVYQEGNSAAQLHE
RSRFIKEKGQWLYTDGDRLPPFQPKKNEPCWCKSGKKFKQCHRKKN
Download sequence
Identical sequences B0C565
WP_012161843.1.67183 329726.AM1_1268 gi|158334447|ref|YP_001515619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]