SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334853|ref|YP_001516025.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334853|ref|YP_001516025.1|
Domain Number 1 Region: 72-288
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.45e-50
Family Legume lectins 0.0008
Further Details:      
 
Domain Number 2 Region: 4-63
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000916
Family All0351-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158334853|ref|YP_001516025.1|
Sequence length 289
Comment protein kinase [Acaryochloris marina MBIC11017]
Sequence
MFGDVNNGTLYAATFDSNRQISNVQVFDSNIPFVVDMKTGPDGRLYGVDLVSGEILKWEP
VTLLPSPQPNLSASFNNFADLSSLNLNGSASGANSRLRLTPASGNRAGSAFFNQAFQVGG
NTSFSTQFQFQITGSQGTNGADGFSLVLQNSPAGSNAVGRFGGDIGYGGITRSIAIEFDT
FNNGPMDLNSNHLSILSNGITDAPLASVNAPFDLNNGDTLTAWVDYNGTTNLLQVYLANS
TIQPSTAVLSANVDLAGLLGNQAFIGFTAGTGGLVNNHEILTWSFSSTV
Download sequence
Identical sequences B0CB72
329726.AM1_1690 gi|158334853|ref|YP_001516025.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]