SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158334884|ref|YP_001516056.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334884|ref|YP_001516056.1|
Domain Number 1 Region: 3-133
Classification Level Classification E-value
Superfamily CheY-like 2.99e-40
Family CheY-related 0.0000822
Further Details:      
 
Domain Number 2 Region: 139-234
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 9.07e-25
Family PhoB-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158334884|ref|YP_001516056.1|
Sequence length 241
Comment two-component transcriptional regulator [Acaryochloris marina MBIC11017]
Sequence
MSQILLVDDEVELTDALGRLLKREGYSVDVANDGEAALLAVQQKIDQGQLYDLLILDWML
PKLSGIEVCQELRSQSQLTPVLFLTAKDTLDDRVQGLDAGADDYLVKPFELRELLARVRA
LLRRSEQFSQTSPEALFQRIQMEGLELDLESQIAYCQGQAITLSEKESQLLTYLMQHPHQ
LLTHDQIYQHLWPSGDQPSSNVLAAQIRLLRRKIAAKNSPPLIHTIYGKGYWFGAKVEAE
P
Download sequence
Identical sequences B0CBA3
329726.AM1_1721 WP_012162259.1.67183 gi|158334884|ref|YP_001516056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]