SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158334953|ref|YP_001516125.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158334953|ref|YP_001516125.1|
Domain Number - Region: 41-100
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000458
Family Apolipoprotein A-I 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158334953|ref|YP_001516125.1|
Sequence length 107
Comment hypothetical protein AM1_1790 [Acaryochloris marina MBIC11017]
Sequence
MDNNNFLKQMLMIGVGTTSFVADKLREVSDQWVNEGRLNPEQAKAFVDDLLQQMRSDPGD
WEAQMERQVRNMMQDLGLARQAEVDELRGRIDRLERQVRDLENKLWR
Download sequence
Identical sequences B0CCC6
WP_012162321.1.67183 gi|158334953|ref|YP_001516125.1| 329726.AM1_1790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]