SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158335061|ref|YP_001516233.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335061|ref|YP_001516233.1|
Domain Number 1 Region: 99-205
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.89e-22
Family UbiE/COQ5-like 0.037
Further Details:      
 
Weak hits

Sequence:  gi|158335061|ref|YP_001516233.1|
Domain Number - Region: 8-56
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0527
Family PhnA zinc-binding domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158335061|ref|YP_001516233.1|
Sequence length 234
Comment methyltransferase [Acaryochloris marina MBIC11017]
Sequence
MPIVKTLKKSLYFGTQHHCPICQSNVRLFKPMHTTQIRLNAICPVCSSLERHRMMWLFFK
QKTDLFAAHAKKMLHIAPEECLVDKFAQCESIDYLTADLNNSAMVKMDLTDIQYPDNSFD
IIYCSHVLEHIPDDAQAMRELSRVLKPEGWAVIQVPILREQTYEDLSITDPQQREQLFGQ
SDHVRVYGLDYKERLEKAGFCVSVMPYLQEFTSEERKRFGFDIEKDDIYFCTLH
Download sequence
Identical sequences B0CEF3
329726.AM1_1901 WP_012162421.1.67183 gi|158335061|ref|YP_001516233.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]