SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158335127|ref|YP_001516299.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335127|ref|YP_001516299.1|
Domain Number 1 Region: 4-270
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.3e-25
Family Tryptophan biosynthesis enzymes 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158335127|ref|YP_001516299.1|
Sequence length 282
Comment BtpA protein [Acaryochloris marina MBIC11017]
Sequence
MELQHIFKSPNPIIGVVHLLPLPTSPRWGGSLKAVIARAEQESTALAAGGVDGLIIENFF
DAPFTKGTVDPAVVSAMSLVVQRVKNLVPLPIGINVLRNDACSAMAIASCVEAQFIRVNV
LTGVMETDQGLIEGEAHRLLRYRRELGSDVKIFADVLVKHARPLGAPNLTTTVHETIERG
LADGIIISGWETGSPPNIGDLELAIDAAKDVPVFIGSGANWENIPSLIQAADGAIVSSSL
KRHGQVDQPIDPIRVSRFVEAMRRSLTQQDAANVKSSVMLES
Download sequence
Identical sequences B0CFG6
WP_012162483.1.67183 gi|158335127|ref|YP_001516299.1| 329726.AM1_1968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]