SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158335143|ref|YP_001516315.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158335143|ref|YP_001516315.1|
Domain Number - Region: 175-225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000362
Family Leech intramolecular trans-sialidase, N-terminal domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158335143|ref|YP_001516315.1|
Sequence length 499
Comment vanZ like family protein [Acaryochloris marina MBIC11017]
Sequence
MKHRPTKLVMTVALWLGSLTLIAISTLSPFTFNLHDLNLKDAISLGIRNPTNPIDIVANI
ILFLPLGFSSYALTLRLPRRKTVLCLMSIGVLSTSISILVETAQLFLPGRFPTLSDIVFN
GFGGFLGGLFALQLSIPKDKRFPTKLNKTVCLIAFLGYFLSIYLGLFLFTCQIQISNWQT
SYPLTIGNTATGDNPWLGKVSNILLFDSALTSDSIGHLLNFKLDSTSYKSLAFSCLLEPD
IIESNYLASELHLCKNPTPQKKLHPQADNDVWYLVESSNLDFINRIKSNKAFTIALKIKS
EFNRGFGTVLTIAEDIDHVNFILGIQANRLTSRIRFPLSGVSGKTPELVIHDKNLNSIDQ
TIVIVYDSISFHVYQNHLNQEKQASLLADLYFTQPLSKIYREWRLELFNIDLHKWLFIAF
TFTPAIVLFELLQATGKINSSREISQCVIGLSILAALISRVYTSSLNIWIFEWMEVLAIL
LFCWFGTKLYFITLEKYQL
Download sequence
Identical sequences B0CFI2
gi|158335143|ref|YP_001516315.1| 329726.AM1_1984 WP_012162498.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]