SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158335200|ref|YP_001516372.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335200|ref|YP_001516372.1|
Domain Number 1 Region: 1-576
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 3.79e-182
Family Prokaryotic type I DNA topoisomerase 0.00000000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158335200|ref|YP_001516372.1|
Sequence length 892
Comment DNA topoisomerase I [Acaryochloris marina MBIC11017]
Sequence
MSTLVIVESPTKAKTIRNYLPSGYRVEASMGHVRDLPRTASEIPAAVKGEKWSSLGVNVQ
SDFEPLYVVPKDKKKIVKELKEALKNSDELVLATDEDREGESISWHLLQLLKPKVPTKRM
VFHEITDEAIKAALTNCREVDQRLVRAQETRRILDRLVGYTLSPLLWKKIAPSLSAGRVQ
SVAVRLLVKRERERRAFRQGSYWDLKAALSKDKSSFESRLVTLADKRLATGNDFDENTGQ
IIAGRDVVLLNEEETLALQARLTDKTWSVAGVDERPSTRKPAPPFITSTLQQEANRKLRL
SARETMRVAQSLYEKGFITYMRTDSVNLSQQAIAAARSCVEDLYGKNYLSPEPRQYKTKS
KGAQEAHEAIRPAGQTFRTPKETDLQGAESKLYDLIWKRTVATQMAEARQTHITVHLEVE
DAGFRSTGKRIDFPGFFRAYVEGSDDPDAALDDQEVLLPSLKQGDTPECTELSPIGHETQ
PPARFTEASLVKMLEKEGIGRPSTYASVIGTIIDRGYAQRQANALVPTFTAFAVTALLEQ
HFPDLVDLSFTARMERRLDGISTGEVEWLPYLSDFYLGDEGLETLVKTRQDQIDPGEART
IDLDNLEAKVRIGRFGPYIETEHEEKPVKASLPKDMTPADLTPEQIEQLLKQKLEGPEKL
GFHPEKGEPIYILLGAYGPYVQLGDVTEENKKPKRASLPKGVAMESVTLDMAVELLSLPR
LLGQHPDTGCKVQVGLGRFGPYVVHDQGKEGKDYRSLKKEDNLFTISFERALELLAMPKG
TRGRRGTKKALKELGSHPEDEAPVNVYDGPYGPYIKHNKTNVSLPEGKKVEDVTLEMALP
LLAEKASTKGKKKTSRAKSTTKKKTTKKTTAKKTTTKKTAAKKTTAKKTTKS
Download sequence
Identical sequences B0CFN9
329726.AM1_2043 gi|158335200|ref|YP_001516372.1| WP_012162550.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]