SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158335261|ref|YP_001516433.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335261|ref|YP_001516433.1|
Domain Number 1 Region: 3-233,326-367
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.47e-34
Family FAD-linked reductases, N-terminal domain 0.0066
Further Details:      
 
Domain Number 2 Region: 233-322
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000000458
Family D-aminoacid oxidase-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158335261|ref|YP_001516433.1|
Sequence length 368
Comment FAD dependent oxidoreductase [Acaryochloris marina MBIC11017]
Sequence
MQIGIIGCGVVGAAIAFELSQTHQVTVWDARSPHQWQATGAALGVLMAAITPKLKGKHLQ
LRLDSLKLYETLIPELEAITHISLPYNRQGILRLCFDGDELNRWSRTQQVRAQQGFHLDI
LDQDQLFQTYPHLKTAHLWESKAPAVGAIYSPQDRQFDPVALSAALITAAQKNGAEVYFN
TTISGFKPLQAGDPRSLTHVCSSTDSYPVDWVIVSAGLGSTPLTTTLQQTVPIYPVLGQA
LHLQRQYPLADLLPVVNGDQAHIVPLNASEVWVGATVEFPSEVGGAIEADPVQLKELHQR
VIALDASLAHAKVLRTWSGLRPRPHERPAPIIERLPGYDNVVVASGHYRNGVLLAPITAQ
KVRQLISN
Download sequence
Identical sequences B0BYV3
WP_012162607.1.67183 329726.AM1_2104 gi|158335261|ref|YP_001516433.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]