SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158335292|ref|YP_001516464.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335292|ref|YP_001516464.1|
Domain Number 1 Region: 461-638
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.59e-53
Family N-acetylmuramoyl-L-alanine amidase-like 0.0000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158335292|ref|YP_001516464.1|
Sequence length 642
Comment N-acetylmuramoyl-L-alanine amidase [Acaryochloris marina MBIC11017]
Sequence
MRHHLQTVHRQRGTTHSLRWLLPSLCGLFLSCLPAEAAQLQSWRFDQNQNRLEFTTDEEI
RPRVQLIPNPTRLVVDLPGIVLGQRTLKQRLGSQFRSVRLGQVNAQTARIVVELDPAYTL
DPQEVKVEGNSPTNWSINLPTPQRWQSSGETTNNTPTASAPAPLPPSQVVQPAPTPSPKI
VSTKPSSPPLQIAQSSSGISDILVTVDGLFLPTKKSKPKVKVKRSRNKKEITFKISGTTI
APQLAKTFTPGYHGIKAMTLKSVSDSEAELLLKVDKDSPDWMASVSRFSGIVLLPKGGPS
ANRSARRPGTTVSLVSPNRSTAPTASTSQINTIRRIDLGGRQLLVKADQPISYTTRWSGR
AYQITINSAKLADDLRKPRLGSGSPLSDISVTESDRNTVIITAKPSTNVRVTGVQRLSNQ
SIALNLLRPGQRPITRIPSNPFPSSTKSPPPVTGRPVRGRKVIVIDPGHGGPDPGAIGIG
GLRETNVVLDISLEVSRILQRQGVVVYLTRTREVDVDLPPRVRLAERVRATAFVSIHANA
ISMSRPDVNGLETYHAPGARLGARLARTVHNTILRRLRMPDRRVRPARFYVIRKTSMPAI
LVETGFLTGAQDIVRLRNPAWRKQMAQAIAQGILNYLNGRYN
Download sequence
Identical sequences B0BZU0
WP_012162631.1.67183 gi|158335292|ref|YP_001516464.1| 329726.AM1_2136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]