SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158335313|ref|YP_001516485.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335313|ref|YP_001516485.1|
Domain Number 1 Region: 6-378
Classification Level Classification E-value
Superfamily Citrate synthase 4.71e-135
Family Citrate synthase 0.0000000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158335313|ref|YP_001516485.1|
Sequence length 378
Comment citrate synthase [Acaryochloris marina MBIC11017]
Sequence
MVACEFQPGLEGIPAAQSQISFVNGQVGKLEYRGVPIEALADNSSFLETAYLLIWGEFPK
SDDLDAFQEEITHHRRIKYRIRDMMKCFPESGHPMDALQASAAALGLFYSRRALDDPIYI
RRAVVRLLAKIPTMVAAFEHIRKGNDPVRPRDDLSYAANFLYMMNEQEPDPFLAQIFDTC
LILHAEHTMNASTFSARVTASTLTDPYAIVASAVGTLAGPLHGGANEEVITMLAEIGSVE
NVQPFLEEKLATKSKIMGFGHRVYKVKDPRAKILQKLAEQLFDKTGGDPSYEIALALEKA
VAEKLGSKGIYPNVDFYSGLVYQKLGIPTDLFTPIFAIARVAGWLAHWREQLETNRIYRP
SQVYIGDHSLAYIPPESR
Download sequence
Identical sequences B0BZW1
WP_012162651.1.67183 gi|158335313|ref|YP_001516485.1| 329726.AM1_2157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]