SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158335363|ref|YP_001516535.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335363|ref|YP_001516535.1|
Domain Number 1 Region: 66-196
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.15e-17
Family AD-003 protein-like 0.079
Further Details:      
 
Weak hits

Sequence:  gi|158335363|ref|YP_001516535.1|
Domain Number - Region: 4-57
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0998
Family Erythroid transcription factor GATA-1 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158335363|ref|YP_001516535.1|
Sequence length 218
Comment hypothetical protein AM1_2208 [Acaryochloris marina MBIC11017]
Sequence
MPNSDRCCPLCQSIQTSAFHQDSRTYFRCQVCLLVFVLPHQFLSAQAEKAIYDTHENSAE
DLGYRRFLNRLFLPLSQRLLPQSVGLDFGSGPGPTLSVMFEEAGHSMELYDLFYAPDTRV
LQRQYDFISASEVVEHLHHPRRELERLWSCLKPNGVFGIMTKRVIDQAAFARWHYKSDLT
HVCFFSIETFEWLANHWQAALTISGNDVVLLTKTAAMD
Download sequence
Identical sequences B0C0W2
gi|158335363|ref|YP_001516535.1| WP_012162697.1.67183 329726.AM1_2208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]