SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158335563|ref|YP_001516735.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335563|ref|YP_001516735.1|
Domain Number 1 Region: 31-285
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.13e-44
Family TK-like PP module 0.0014
Further Details:      
 
Domain Number 2 Region: 299-488
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.13e-29
Family TK-like Pyr module 0.034
Further Details:      
 
Domain Number 3 Region: 503-631
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.83e-20
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158335563|ref|YP_001516735.1|
Sequence length 633
Comment transketolase [Acaryochloris marina MBIC11017]
Sequence
MTTFPIDLKAYKPLTLDASNPTLTPEQRETLKSNIQLCRDAIVFFTATGAARGVGGHTGG
PYDTVPEVMILDALFRGSADKYVPIFFDEAGHRVATQYLMSTLEGSLPAEQLMSYRAANS
TLPGHPELGLTPGVKFSSGRLGHMWPYVNGVALANPGKTAFCLGSDGSQQEGNDAEAARL
AVAQQINVKLLIDDNDITIAGSPSDYLPGFSVKKTLEGHGLKVLEGDGEDIDGLYARICE
AINTPGPVAVINKRAMCVGIDGLEGSNHGHDVISVDAALKYLEARGHSDAVSNLKSVVKP
SQDYTFLGASEKYDSNRNVFGDAVVEVLSGMSEADRKAKVLVVDSDLEGSCGLHKIRAAN
PEIFISGGIQERGNLSAAAGFGMAAGKQGIFATFSAFLEMCISEITMARLNKSNLLCHFS
HAGIDDMADNTCHFGINNMFADNGLDDGYETRLYFPADANQMKACVKSVFDNSGLRFIFS
TRSKVPLLTDANGGELYAGNYTFTPGKDEVVREGTAGYIVSFGEALYRSLDAVERLKKEG
IDVGLINKSTLNVVDEDMMKKIGAAPFVVVVESFNRRTGLGSRFGSWLLERGLSPKFAYL
GTHEEGCGGLWEQFPHQGIDPVGIMKTVKSLAS
Download sequence
Identical sequences B0C374
gi|158335563|ref|YP_001516735.1| 329726.AM1_2413 WP_012162887.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]