SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158335664|ref|YP_001516836.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335664|ref|YP_001516836.1|
Domain Number 1 Region: 34-208
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.85e-71
Family HD domain 0.00000227
Further Details:      
 
Domain Number 2 Region: 197-414
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.52e-60
Family RelA/SpoT domain 0.000019
Further Details:      
 
Domain Number 3 Region: 397-469
Classification Level Classification E-value
Superfamily TGS-like 3.05e-23
Family G domain-linked domain 0.06
Further Details:      
 
Domain Number 4 Region: 671-750
Classification Level Classification E-value
Superfamily ACT-like 0.00000000000025
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158335664|ref|YP_001516836.1|
Sequence length 753
Comment ppGpp 3'-pyrophosphohydrolase [Acaryochloris marina MBIC11017]
Sequence
MNLKATVSPTDLELPIWLQECMLEVDGAEDKDGIPEQTLICRAFNFGYQLHEGQRRASGE
PYIAHPVSVAELLRDLGGSAAMIAAGFLHDVVEDTDVTPETIEAEFGLEVRQLVEGVTKL
SKFNFSTKTEREAENFRRMFLAMAQDIRVIVVKLADRLHNMRTLEHLPPVKQRRIAQETR
DVFAPLANRLGIWRFKWELEDLAFKYLEPDTYRRMQQLVADKRTDREDHIEQAITILHDR
LEPICSKHLEISGRPKHLFSISQKMERQQKEFHEIYDVAAVRVIVKTNEECYRALAVVHD
CFRPIPGRFKDYIGLPKSNRYQSLHTVVIGLGGRPLEVQIRTEAMHHIAEYGIAAHWKYK
ESSNQPGKAAWSPDDEKFTWLRQLLEWQSDLKDAQEYLDNVKDNLFDSEVYVFTPKGDLI
DLTQGATPVDFAYRIHTEVGNHCFGARVNGRMVTLDTPLDNGDIVEIMTQNSAHPSLDWL
NFAASNAARNRIRQWYKRSHREENILRGREMLEKALGKKGFDALLKSEPMQIVANRCNYQ
TPDDLLAALGYGEVTLNSVANRLRETIRSQQAEAEPATSDLTDVNLPTQASPRPLPSSGD
SPITGVEGLVYHMAGCCHPVPGEPIIGAVTLSNRGISIHRQGCKNIGNIPGDRLIPVSWN
PTHPSQQSRRYTYPIEVQIEVIDRVGILKDILTRLTDSKVNVHNAQVKTFPGQTAVINLG
LDIEHCNQLDQICAQIRKMSDVLKLRRLSQVED
Download sequence
Identical sequences B0C5E6
329726.AM1_2514 WP_012162982.1.67183 gi|158335664|ref|YP_001516836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]