SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158335837|ref|YP_001517011.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158335837|ref|YP_001517011.1|
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily L28p-like 2.75e-25
Family Ribosomal protein L28 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158335837|ref|YP_001517011.1|
Sequence length 78
Comment 50S ribosomal protein L28 [Acaryochloris marina MBIC11017]
Sequence
MGKKCQLTGKKANNAFAVSHSHRRTHKLQEANLQWKRVWWPQEKRWVKLRLSTKAIKTLE
KKGLAAFAREAGINLNQV
Download sequence
Identical sequences B0C811
WP_010473270.1.53659 WP_010473270.1.67183 gi|158335837|ref|YP_001517011.1| 329726.AM1_2695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]