SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158336005|ref|YP_001517179.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336005|ref|YP_001517179.1|
Domain Number 1 Region: 24-144
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 3.14e-33
Family N-utilization substance G protein NusG, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 117-205
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 5.01e-18
Family N-utilization substance G protein NusG, C-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158336005|ref|YP_001517179.1|
Sequence length 206
Comment transcription antitermination protein NusG [Acaryochloris marina MBIC11017]
Sequence
MTDDPLSTTPAVSSVPEGPLEIRHWYAVQVASGCEKKVKHNLEQRLQTLDVADRIVQIEI
PQTPTIKVRKDGSRLTGEEKVFPGYVLVRMILDDETWQVVKNTPNVINFVGAEQQRRYGR
GRGHVKPMPLSPSEVERIFRQAQEQEPVVKVDMSVGDKIQVLNGPFKDFEGEVIEVSLER
NKLKALLSIFGRDTPVELEFNQVRKE
Download sequence
Identical sequences B0CAC8
WP_010475524.1.53659 WP_010475524.1.67183 329726.AM1_2864 gi|158336005|ref|YP_001517179.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]