SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158336056|ref|YP_001517230.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336056|ref|YP_001517230.1|
Domain Number 1 Region: 4-158
Classification Level Classification E-value
Superfamily IpsF-like 2.22e-64
Family IpsF-like 0.00000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158336056|ref|YP_001517230.1|
Sequence length 161
Comment 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Acaryochloris marina MBIC11017]
Sequence
MTSIRIGNGYDIHQLVEGRPLILGGVQIEHSLGLKGHSDADVLTHAIMDALLGALSLGDI
GHYFPPTDPKWAGADSLKLLEQVHQLILDRGWQIGNIDSVVVAERPKLKPHIEAMRDRIS
QVLNLSPELIGIKATTNEKLGPVGQEQGICSYAVALLTSDS
Download sequence
Identical sequences B0CBC9
329726.AM1_2915 gi|158336056|ref|YP_001517230.1| WP_012163350.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]