SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158336127|ref|YP_001517301.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336127|ref|YP_001517301.1|
Domain Number 1 Region: 176-491
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1e-112
Family Leucine aminopeptidase, C-terminal domain 0.00000043
Further Details:      
 
Domain Number 2 Region: 1-179
Classification Level Classification E-value
Superfamily Macro domain-like 6.47e-29
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158336127|ref|YP_001517301.1|
Sequence length 492
Comment leucyl aminopeptidase [Acaryochloris marina MBIC11017]
Sequence
MKIQAIETVAADWSGDYLGIGFFEDSAAIDAGLTQLDQSLQDILQDLVSETEFQGKVGEQ
PWTRIAGPGSIRKVMLIGLGSPDAFTLDSLRQAAAAFAKAAQKQKAASAGLQLPSWDDDA
AASTQAMAEGIELALHQEIRFKSDPDAKKPGEFPQEVHLLGLANQAAAIEKAQQICAGVI
LTRELVAAPANVVTPSALAETAAQIAEDHGLTLEVLEREECEAQGMGAFLGVSLASELPP
KFIHLTYKPSGTPRRKLAIVGKGVTFDSGGLNLKVGGSGIETMKMDMAGSGATLGAAKAI
GQLKPDVEVHFIVAAAENMISGHALHPGDILTASNGKTIEINNTDAEGRLTLADALVFAE
KQGVDAIVDLATLTGACIVALGNDIAGMWTPEDSLAEELSQASEQAGEKFWRMPLEEKYF
EGLKSPIADMKNTGPRPGGSITAALFLKQYIENTPWAHLDVAGPVWTEKENGYLNVGATG
FAVRTLVNWVMG
Download sequence
Identical sequences B0CCF6
329726.AM1_2989 gi|158336127|ref|YP_001517301.1| WP_012163418.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]