SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158336332|ref|YP_001517506.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336332|ref|YP_001517506.1|
Domain Number 1 Region: 347-608
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-61
Family Glycosyl hydrolases family 16 0.003
Further Details:      
 
Domain Number 2 Region: 40-169
Classification Level Classification E-value
Superfamily beta-Roll 2.18e-26
Family Serralysin-like metalloprotease, C-terminal domain 0.0014
Further Details:      
 
Domain Number 3 Region: 145-308
Classification Level Classification E-value
Superfamily beta-Roll 5.75e-16
Family Serralysin-like metalloprotease, C-terminal domain 0.0018
Further Details:      
 
Domain Number 4 Region: 599-746
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000000183
Family Serralysin-like metalloprotease, C-terminal domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158336332|ref|YP_001517506.1|
Sequence length 760
Comment type I secretion target repeat-containing protein [Acaryochloris marina MBIC11017]
Sequence
MRTIKSFFLSDGDDIWGGWEDLVDYIVYGRKGNDKLYGYNGNDTLFGEEGNDEIYGSLGD
DSLDGGDGNDTLNGGAGNDTISGQGGNDLIFGDVSNDFLYGNDGDDLIFGFDGVDFLDGG
AGKDSLYGENDNDTLYGRGGADLLDGGAGDDVLYGNGGKDVLYGYTGQDSLEGGNGHDTL
DGGTGNDQLWGGKGNDSLNGGAQDDVLDGVRASNNSHSGVNTIDTLLGGEGADAFILGDS
ISAYYDDGNAATQGDNDYAVIQDLNRLQDSIQLHGSASDYVVSDIPTSLQSQFSGENAGI
YLDTNNNGTWDSTDELVAVVENLKADSVVLSANYFDYTDNPNATDWHPANDSNWELVFQD
EFNGTSLDESFWNTRYTHHNHYNGRTNLWNNEAQYYVGDNEVIDGVTYDGMDIENGTLKL
LGQKLDQGITADIIDPLTGYADTQTFGYTSGMISSHNKQAFTHGYMEIRAQVPSGEALWP
AFWMLPTDGGWPPEIDVMEVLGDQTDRIFTSLHYTDGQSNIASESGEQVFSNIDFSADFH
TFGAQWDADKITWFVDGQALYEITHDIPDVPMYLISNLAIGGDWPGQPTANTPDQSSLNI
DYVRVYQDASGILHGGLADDVLSKDLGDLAGEAGNDTLTGGTGDNHLDGGAGDDMLWGSE
GLDTMMGGLGLDQFILGDASGLFYDDGDVNTSGATDYANILDFALSDDVIQLQGSAADYV
LGLAQDGVSTEIWHEQATNELIGVVSQVTLNDFSQGFVFV
Download sequence
Identical sequences B0CET5
WP_012163607.1.67183 329726.AM1_3194 gi|158336332|ref|YP_001517506.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]