SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158336363|ref|YP_001517537.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336363|ref|YP_001517537.1|
Domain Number 1 Region: 4-206
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.04e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.045
Further Details:      
 
Domain Number 2 Region: 168-199,260-351
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000013
Family C-terminal domain of adrenodoxin reductase-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158336363|ref|YP_001517537.1|
Sequence length 448
Comment monooxygenase flavin binding family protein [Acaryochloris marina MBIC11017]
Sequence
MQTTSEKYLIIGAGYAGLGMAQALKEAGIPYDQVDASDDIGGNWYHGVYETAHIISSRNI
TQFTNFPMPETYPDFPSAQNMRDYINAFTDHFGLRDTIELNREITFVRPVEDNLWEVSFA
NDEQRLYQGVVLCNGHHWCKRLPKFEGHFNGEIIHSKDYKRPQQLIGKRILVIGAGNSAC
DLAAEAARVGAKCVLSMRDTPWFIPKTFAGVPVADLSKNSKGPSPLWYQRLMVYLLIRLT
FGKHESYGLPTPKHRIFEKHPTINSEVPYYIKHGRITPKPGIRKLDGDSVEFEDGSREDF
DLIVCATGYYVAYPFLAPELQRVQGSVVKCYDGAFLDDYKGLYFVGWYQPRGGIGSIISA
FAPVLARYLKLQETINVPIGLVLKTLGKTLPTTHLFDPQQIFSDLEQTDRQFSSITQKAH
QIDAQHPNFRNQPLPAQTHDMLRTTMSN
Download sequence
Identical sequences B0CFR7
gi|158336363|ref|YP_001517537.1| WP_012163634.1.67183 329726.AM1_3225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]