SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158336438|ref|YP_001517612.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336438|ref|YP_001517612.1|
Domain Number 1 Region: 1114-1427
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000000102
Family Galacturonase 0.011
Further Details:      
 
Domain Number 2 Region: 1348-1581
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000014
Family Galacturonase 0.077
Further Details:      
 
Domain Number 3 Region: 484-815
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000384
Family Galacturonase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158336438|ref|YP_001517612.1|
Sequence length 1666
Comment hypothetical protein AM1_3302 [Acaryochloris marina MBIC11017]
Sequence
MARRLIINPLLFPHWGQALTLSVLISGLCPLTASATQKALITPLDPLPTSFEEEDASSTP
AIVSAHFTPMADLDLALKPKAISGQTESNLKQDLTLASVKAQGPSPDGNTSVLPHSPRTL
AEAGWIPKTQTLTAKPNSPIPANATAQAEPASTEETNLPPQAPSDAPSQTLEEPAPSASL
DIPYFVDAEFRGSTRRQFGVLNLRLPFFQDEKSFAFADVHFEAGSNETFLGNLGLAYRRV
LNTAEENPWILGTHAFYDTTRSENGFQYHQGSLGAELISKKFEFRVNGYLPGSNPNTVGQ
RTINDVLGIQPRANGLGTNIVRQDITLTAQERALAGFDFEVGHRHHFSDKVSLGLFGGYF
FFDSSETLSIDGPMARAQLEVQDPLGMNGGLLQVGSRFRFDETRGSELEGFVRLGIPFGG
PQRSEPLSLTQRLARRPIERHYEITTFAQDINRPISLTELQAAVVGQSTLSPLGPQISAI
TSQVALNPATGQPLNIFFVDGDGTAGDGTQTNPLTVAQATSSITQANDVLFFLDDAGSID
TQTGLGNSLTLKTGQQALGIGTTPNFVFTVPNLGSVTVFDAGQPQLVNGANNNVLTLANN
NTIDGLAFNGQNTAPRGIAAVTGATNTTIRNSNLSNFTVAGVQITPSTNTIIDNVVFNNN
ATDVIVNAANTTLTNVVSNNATGPAIQILNATGTTTLTNVNISNSGGDGLQFANPSGTIT
ATNVDITNADDNGLEITSGDGTFIFDATSSITDTTNAALNVVGGTTTITYNGTITQNNPA
SAVNITDKTGSTTTFNGLVTANTSTAPGVNLTNNTGSTIAFNGGLDIDTTTGTGFNATNG
GTVNVAATSEDESVTTTSGTALNLNNIAANITFDSVSSTGGTNGINLDTVIGSVGVSGTT
TIANTTGDGFLATNSTGTYTFGPVTITNAGLDGLDLSGINDATTVFNLGALTINGFTGTG
INLAGANVGVTAPTVAITNTGNVGTGIDLTNTTGNRVITLGDPTNTAGDTPSSIAGVNVG
AQLNNANANFTFGDGEQTTDTPSTIAATTPIDASAVGANGTYNFLDIAFADSPGLRFSDV
FYVDNVPGGTGTRTNPADVPLGETNTNPNDVIVLVDNSGTDVIDAAGSNGNNTFQLQDGQ
TLVSFLNGSVTVGAGGPANVLANITITDPTGNGAPTLTTTGANTNTVTLANNNTIDGVQI
ATNATRVDAIDGTNIASMTIRNSAISSSRSGIELTNPTGTVTIENNQITDAGSRGIHVND
FADTGEVTITVANNQVNNTNNDAIHFDTINNDANVTITVNNNRIDGGSRRTDDGIEFDDI
EGNAVANITITNNQITDVAFEGIEFGFFENNAQSTILIDNNQITNAGDIGIQFDDLENRT
TTNIIISNNILTDIDEEGIEFDLIENSAVANITIDNNQITNTSLEGIEFDDIENTATATI
RISNNVLNTIGQEGIEFGFIENSSMANITIDNNQITNIATEGIEFDDIQNTATANIQIAN
NVFNTIGQEGIEFDFIENSAVANITIANNQMNNLGADGIEFDDIENTTTANITISDNTIN
DAGAHGVFFDRIEQNANATVTLTGNTIANPGGDGIQARHTANTNFCLTLSTNTVNTPGGA
GFHFISTGAGDFQIADRANVLTNNTGAFNPADVETNANFASVATCP
Download sequence
Identical sequences B0BYZ6
329726.AM1_3302 gi|158336438|ref|YP_001517612.1| WP_012163702.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]