SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158336823|ref|YP_001517997.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336823|ref|YP_001517997.1|
Domain Number 1 Region: 531-866
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000289
Family Pectate lyase-like 0.061
Further Details:      
 
Domain Number 2 Region: 2045-2266
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000108
Family Galacturonase 0.026
Further Details:      
 
Domain Number 3 Region: 3184-3371
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000433
Family Galacturonase 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158336823|ref|YP_001517997.1|
Sequence length 3597
Comment hypothetical protein AM1_3691 [Acaryochloris marina MBIC11017]
Sequence
MAGWMSIDPKVRSHLGKSLALSLLIAGVWPMAALAEEISAALPQATEPLGNIGTDPAPLE
APPSAESEITAAYISPPSDFQLALDSADTVPEHSLSPLPQDESITQRPEASLTAPLESDQ
HPQPSPKDLTDQPVIDQLPPTIDTNPPFTASPPRTLAEAGWTTAPQVVAINKGTTPSNLP
AATSHRLVQAEPNVPTDTKTGEKSDTSNDTNTEADTSTNLGIPYFVDTEFRGSTRRQFGG
INLRLPFWQDDQSFAFADVHFEGGSNETFLGNLGLAYRRILNTSNENPWILGTHAFYDSK
RSENGFQYHQGSLGAELVNKKFEFRVNGYLPGSNPNVVGQRTINGVLGIQPRANGLGTNI
VQQTLTLEARERALAGFDFEAGHRHHFNDKVSLGLFGGYFFFDSRETLSIDGPMARTQLE
VQDPLGMNGGLLQVGGRFRFDETRGSELEGFVRLGIPFGGPKRSQPLTLTQRLARRPIER
EYEITTFAQDINRPISMAELQAAAAGQGSLSPLGPQIIASNSQVALNPATGLPINIFFID
GDGTAGSGTQSSPLTIAQASALTQANDILFFLNDAGAIDTQTGTGGTLSLKEGQQALGVG
TTPNFVFTVPNLGSVTIFDAGQPQLVNGANNNVLTLANNNTIDGLAFNGQNTAPRGIAAV
TGATNTTIRNSSLGNFTIAGIQITPSTNTTIDNVVFNNNATDAIVNAANTTLANVASTNA
TGPAIQILNATGTTTLTNVNISNSGGDGLQFANPSGTITATNVDITNAGDNSIDITGGDA
TFTFDDTSSITNATSSAFNVAGGTTTVTYNGTVTQNNPASAVNIADKTGGTTTFNGLVTA
NTSTAPGVNLTNNTGNTVAFNGGLDIDTTTGTGFNATNGGTVNVTATSGDESVTTTSGTA
LNLNNIAANITFDSVSSTGGTNGINLDTVTGSVGVSGTTTIANTTGDGFLATNSTGTYTF
GPVTITNAGLDGLDLSGINDATTVFNLGALTINGFTGTGINLAGANVGVTAPTVAITNTG
NVGTGIDLTNTTGNRVITLGDPANINGDTPSSIAGVSVGVQLNNANANFIFGDGELTVDA
PSTIAATTPIDASAVGTNGTYNFRDVAFAGSPGLGFTFPELFFVDQNTNGSGATITDPGS
ITAAEASPTADIFILVNTSGTDVIDAINAGGSFDLTANQQILSFRNGSTINVPFAGPGNV
LLNASTGSITDTTGNGVPTLTTTGAGTPATVAFANNNTINGVVLDNGSNGPAVSGTGLAG
TATIQQSTLPTVDFNGGTVNVNITGSTLNNGNPLATVNVSGGHTGALTVDAATTINATNG
NGLQFDNADGTYTFNSPITLNGGDAGIDILNGSGGTFAFANTAITNPTGIAYNEDTSTAT
VTYTGTITQNNAVSAININNKTGGTTTFNGLVTANTGTATGVNLTSNAGSTVSFTGGLDI
DTTTAIGFNVTGSTVNVGAMGSTGTYTVVTTDGLAVNIADSTVNTTFNSISATRSTSGSG
ITLSNLDGAFTVNGGTLSSPVGGNQNSFSIIQNDVTTTRNLTVAIDGISIIHDATASIGG
LDFGVFAETRDDDQLVLSIANSIFKTEDQGVVIQGITEGLIVTDFSNNTLQGDSTAFNPA
FMANGFRFDGVVFDADPNTAGLQEVQGGTLTLGSPTERTSFGFTAATLDTGRSSRGTIRF
DQFNANVTNAAILTNASSADLTIRILDGNVDAGQIDLNQVNSEITLSSLNLNGDGFDSGF
VANQVTGSFTVTGATSITAPEISQEIGAQFFSPNPSAGTTQGINISNSSANFAFNSISIA
PSTITPATGNVLTNGGPTVGIQLTGNTGTFTATGTTTINTTVEDGILISNNPGNVTFGTT
NISNPGAPIVPTPLFTPRVIDAAGIDIEGVNNGAIAFGNTSITNFGDDTGVDFAGSDPVG
GVRFTSLNIAGTGTAGSVGIDLSSTLGNRLIQVGDSMNPGTDTPSSIANVEIGVELSSSQ
AVGTTANVNFIFGDGEDTVDQASTISVTAGGFTVQAVGLDPASGTYNFNDVTFTGNPNFP
GGAGVAGQLFFVSDTGTGNGSSPTQAASVAAAQTQANLATVNTFVFINNGTTYNFDTLLA
AAGNSFTLGTGDAIDGFGNGQTFGFQQPANVLGTFPSTNITDPTGNGAAVLSTSAGNNVI
TLANNNTIQNVIFDGSSTATRAIAGLTGANNTTIQNTTIQNFTTGIEITPSTNTTLNNVT
FSGNNTDVIVNAADTMLSNITSTGTTGTSLQITNATGTTTLQNVSLAGGVVFTNAAGTIN
IDNLDITNATGIGVDISGGNATFDFDTASSITNPTSTAFNLNGGTASITYSGSIAQANNA
STVNVTGGHSTGTVTFQTGMLSATNGNGLQFNNADGTYNFNGTTTLNGSDAGIDILNGSA
GTFTFANTTITSPTGISLNVDGGAANINYNGTSSIAQANNVSAVNVQSGHTGTITFANTT
NINATNGNGLQFNNADGTYNFNGTTTLNGGDAGIDILNGSAGTFTFSANTSITSPSGTAF
NEDTSTASVTYAGTITQNNAASAVNINNKTGNTTAFNGLVTANTSTAPGINLTNNTGSTI
NFNGGLNIDTTTGTGLNATTGGTVGVAATAGDESVTTTSGQAINLNGIASNITVDTVSST
AGASGISLNTLTGSFAVTGTTTVNSPTGNAIALTSNSGTLTFGTVNIDLGTTASTSGIRY
VGTNAATTFGTTTITDVGAAANQVGINFNGATLSGTAAYNSVAISGPDTSTNSIGVDLTA
LAGNQTVNLGTQTTPATGPSSSITDLHRGVVIDNTAAVQFTFGDGESASDTGSSINVNAQ
AGAFTVDAGNGTLAASSFDFEDVTFGAGDAANFPAGAASATFVSQNGGTLTAGSFGLSQS
ISTISVAAADLLAGTETFAFIGNIDVTAQGATGFTLATGQSITGFANTNSVSFGSIKPAN
ILGTFSTVGGTITANSAVITNSTAGSDVLTLGGNNTIEHNTFEYSTGTANIFDIDNATAG
FSNGTGITIQNNVIQNVSANATVFNVANLTTNVTAQNNTINVAGALLNANGGTGNITITR
GTGTAFSARNVNVANKTGGTVAITGPLTLNSGTVNAVNLTSNTGATINFAGSNLDIDTTT
GIGFNATNGGTVNVTGTANTINSGATTALNIANTTIGTSGVTFQSISANGGTNGINLNNV
GSGGFNVTGDGATLGSGGLIDNSTGAGIRLSNAQNISLSFIDVTDGGDDGIFGDNVNGFT
LTSGRILRNGNANGESGIQFGDTTTPLNGVTGAVSITNSLIDSSQSFGIDIRNSSGTLSS
LTLTGNTISNNTQDSAFVYEGTGTSVLTTANIANNTIQNIPASAFIINVTDQGTADVVLD
GNTITGTNTFGQITSNLNAVVNFDIRNHGTAGNPVLFSNAASDGINVLLGSQSTTSGRLQ
GNIDNNFISLTDTNNFGEPIEAIAQGNGTLTITITDNTLVNDGFNEVVRLFARDGDNTFN
ATITGNTLTQSNIFGLPGIFFQSGASGSTTDDINACADIGGAGALANTITTEAGVIDIRL
RLRSSTDSFVLPGFTGLGTSATDVETYLTGRNNGVADNTTIDAGLTFSGGVSCPTPP
Download sequence
Identical sequences B0C4D7
329726.AM1_3691 gi|158336823|ref|YP_001517997.1| WP_012164066.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]