SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158336876|ref|YP_001518051.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336876|ref|YP_001518051.1|
Domain Number 1 Region: 39-121,169-290
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.13e-24
Family AstE/AspA-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158336876|ref|YP_001518051.1|
Sequence length 361
Comment hypothetical protein AM1_3744 [Acaryochloris marina MBIC11017]
Sequence
MFPSEYWQGRDRFRHAAQSLNCVLETYPIQALGPQDRALSIDVARYGSKSPHTTLLVSSG
LHGVEGYCGSAIQWALLTDVLPQLTLPKGVAVLLIHALNPYGFAWNRRCNEDNIDLNRNF
LLPEQSFTGSPEAYTQLDAFLNPRQPPTPQELYTLKLLGYALRYGVSSLKQALPVGQYEF
PQGLFFGGQAPAQTQQILASQLPTWLGPTQRIVHLDLHTGLGRWTAPTFLVKPQVHQTDL
PWFQQTFTAEGLQILGQQGATYICQGDIGPWCQALMQDCDYRFATVEFGTYPLLPVLKAM
RAENQAHWWDEPGSSTYAWAKSLLLEANAPTSDEWRQAVVAKGIDLIHQAFAGLNELCPT
Y
Download sequence
Identical sequences B0C5L3
329726.AM1_3744 gi|158336876|ref|YP_001518051.1| WP_012164113.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]