SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158336909|ref|YP_001518084.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158336909|ref|YP_001518084.1|
Domain Number - Region: 30-65
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00301
Family Mitotic arrest deficient-like 1, Mad1 0.0095
Further Details:      
 
Domain Number - Region: 185-228
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.0701
Family Anticodon-binding domain of Class II aaRS 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158336909|ref|YP_001518084.1|
Sequence length 318
Comment S-layer protein [Acaryochloris marina MBIC11017]
Sequence
MKIVTKKPVFRSLLSLSLLSSWLLIGGCNQANQDSTQTTDEVAELKSKLQDLEAENKTLK
EQQDEIGLGSDPLKEAKPVSEIVSKAPEDTSDNAPVSEAETTKPAAVAFKDIADLPTQPL
IADLIKLEILEATDDQNFQPYESISRGEYMLWLFKAHNAISRPAQKIRLAPTFDPEFTDI
DAKHPAFKVVQALANAGYSVGYDDKTFKPDQPITREEMISIKVGIDKGKSIKPVSASSLR
AAWKFSDIAEIDKRHSGYIYNDLFTKGPQGSNIERAFGKIGTFKPKQAAKRHEAAATLWQ
IGRETAPKALERKEKELS
Download sequence
Identical sequences B0C5P6
329726.AM1_3780 gi|158336909|ref|YP_001518084.1| WP_012164142.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]