SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158337128|ref|YP_001518303.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337128|ref|YP_001518303.1|
Domain Number 1 Region: 19-396
Classification Level Classification E-value
Superfamily Citrate synthase 4.32e-127
Family Citrate synthase 0.0000000533
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158337128|ref|YP_001518303.1|
Sequence length 397
Comment citrate synthase [Acaryochloris marina MBIC11017]
Sequence
MRERFYRQQDDTIPTGAKQMTTCDYVPGLGGIPAAQSRVSYVDGQAGQLEYRGIPITELA
EHSNFLETAFLLIWGHLPTPEDLSLFQYEVIHHRRIKYRLVDMMKCFPERGHPLDAIQAT
VAALGLYHSRRAFNDPAYIRRAVVRLLAKIPTAVAAFEHIRKGNDPLRPRDDLNYAANFL
YLLSEQEPDPQKAHIFDQCLILHAEHTMNASTFSARVTASTLTDPYAVVASAMGTLGGRL
HGGANEEVMQMLTDIGSVENVKPYLDQQLAQGRRIMGFGHRIYKVKDPRAQIMQGLAEQL
SENYGCDRYYGIALALEKAVEERLGDRQIHANVEFYSGLIFRQLGFPADIFTSLFAIARV
AGWLAHWKEQLDTNRIYRPSQIYMGQHDQPYIPVVDR
Download sequence
Identical sequences B0C9H3
gi|158337128|ref|YP_001518303.1| 329726.AM1_4002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]