SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158337208|ref|YP_001518383.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337208|ref|YP_001518383.1|
Domain Number 1 Region: 68-355
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.57e-48
Family Bacterial dinuclear zinc exopeptidases 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158337208|ref|YP_001518383.1|
Sequence length 367
Comment M28 family peptidase [Acaryochloris marina MBIC11017]
Sequence
MKGVRQWLGFSRGKMFKSRKAWILSAIACLFVVFMSCQSPRPVAQSPPVSPSPEATPAAS
PPDAPSPTTAPLPVTAEPPPLVNGDRLMADLNALNFERYTTAELKKTRAFMAQTLSASGW
TVTEQPFETGVNLVAERPGIAPNAGVLLVGAHYDSVRGSPGSDDNATGVVVALEVARLLG
DRKTIRPLRIVLFDQEEAGLVGSYAYAQRPENLKNLDGVVILEMLGYSCSTPGCQQVPGE
FKVKLPSDKGDFLAIAGDTEHLPLLNAFSEHHQPNLPALVPVSIPFKGLLTPVILRSDHT
PFWFEGIGAVMLTDTAHLRNPHYHRRTDTPDTVDAAFLTGNAQTAVNAITALLDRPQSFL
TTETDKS
Download sequence
Identical sequences B0CAK0
gi|158337208|ref|YP_001518383.1| 329726.AM1_4085 WP_012164413.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]