SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158337435|ref|YP_001518610.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337435|ref|YP_001518610.1|
Domain Number 1 Region: 201-399
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.2e-63
Family B3/B4 domain of PheRS, PheT 0.0000106
Further Details:      
 
Domain Number 2 Region: 35-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.14e-46
Family Myf domain 0.0026
Further Details:      
 
Domain Number 3 Region: 485-698
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.97e-40
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0001
Further Details:      
 
Domain Number 4 Region: 711-812
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.31e-29
Family Anticodon-binding domain of PheRS 0.0003
Further Details:      
 
Domain Number 5 Region: 411-492
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000284
Family Domains B1 and B5 of PheRS-beta, PheT 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158337435|ref|YP_001518610.1|
Sequence length 813
Comment phenylalanyl-tRNA synthetase subunit beta [Acaryochloris marina MBIC11017]
Sequence
MRISLNWLKNLVDIDLSPEDLAEQLTLAGFEVEDIEDLRTWADGVVVGKVLTCESHPNAD
KLRVCTVDIGEAEPSQIVCGAPNVKAGLYVPVATLGTYLPTPDLKIKKAKLRGVPSAGMI
CSLTELGLESEIDGIHSFETDGVAVGNDVRPLLGLDDVILDLTSTANRADALSMVGVARE
VTALTGAKLKLPATPKLEIPSGKDVKVDLSDAEACPAYIATVLENVTIAPSPGWLQQRLI
AAGTRPINNVVDITNYILLEWGQPLHAFDADSLETLAKKKPLTLGVRLAKSGETLTTLDS
QKRKLQEQTLVITANDQPVALGGVMGGEETEVKDTSTRLVLEAALFNSLTIRRSARSQSL
RSEASARYERGVNESQLETACLHALQLLVDLTGAKVVAQQRADHRKSLERSIELRLDRVN
HVLGKVKGKKGEPTDLTAKDILPILKSLSFDTTPTNRPETWTVKVPPHRHSDIEREIDLV
EEIARLYGYDNFCETLPAKTELGTLSSQDALARKLREAFRAVGLTELIHYSWVKPGGDDQ
VVVVNPLLVEFSALRTEMLTSLLNACQRNWEQGNGALNGFEIGQVFWKEGEKLKEARAIA
GILGGDPAQGKWMRTANQDYAMTWFEAKGLLERVLSQLGLSVTFQSDCPDQRLHPGCTAA
LISQGAKLGYFGQIHPQVQQERDLPTVYVFELNLDLLLEQLARLQTKATLFSTYSTYPAA
DRDLAFFIPTEVTVAEIEKVIRKAAGGRKQSLLTAIELFDEYQGEHVPEGQRSLAFRLLY
QACDRTLTDEEVNPIHQKVRNALEKQFKVSLRS
Download sequence
Identical sequences B0CDU1
WP_012164619.1.67183 gi|158337435|ref|YP_001518610.1| 329726.AM1_4313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]