SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158337462|ref|YP_001518637.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337462|ref|YP_001518637.1|
Domain Number 1 Region: 6-287
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.35e-44
Family Filamentous hemagglutinin FhaB, secretion domain 0.016
Further Details:      
 
Domain Number 2 Region: 388-558
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000439
Family Filamentous hemagglutinin FhaB, secretion domain 0.058
Further Details:      
 
Domain Number 3 Region: 523-656
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000973
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Domain Number 4 Region: 304-361,402-427
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000248
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158337462|ref|YP_001518637.1|
Sequence length 814
Comment hemagglutination activity domain-containing protein [Acaryochloris marina MBIC11017]
Sequence
MGLLPSASAQIRPDATLPINSEVRSEGAIQRILGGTQAGQNLFHSFRQFDLPPGTTVYFD
QNPALTNIFARITGGQASSVDGVLRANGATNLFLINPKGILFGPNAQLNVGGSFFATTAN
RILFPNGNAFSTMPTAQSAPLLSINQPLGLAFNQQPGPITVRSGLTVQPGQMLSLLGGDV
NIRGNLTAPGGRIELGAVDVNQQVQLNPSSRGLNYSGVQRFQDIRIDNLAIVDTSGPGGG
LINVQGDRITLAEGGRLQSITLGNLDGGGITVNADTSLEVLGNLSPNSPIDPFIAQRGFF
LPQTTTILATTIGAGQASSIEINTGTLRVIDGAKITAATDGLGLGGNLTINAARSIDVAG
ETILLGFVPEAVPFTEPVTRNFLIDQTSTSQINARSAFIPNSGPSGNITINTGDLTIRDG
ANLTAGSNLGPGGTITLNAIGTVEIVGSSQSGFSTSNVSTASISQNNALDTIIRANKLII
RDGGVITASTFGLGQAGDILITTTQSVEILGISRSGMIPSQINAGTFSAGDSGDIKIDTG
RLSVKDGGTIRLNSVAQGQTGALTVTANSVFLENQSQISSNAVASPAGNINIDTNLLLLN
NGSNITTNAFGLDAGGNINLNADVIAALPLDGDSNITANAVNGPGGQITITTQGLFGIAI
SDRNTDLNDITAISQNNPQLNGVVELNTPDADPSENLAEQPDEVEAPQPIARGCQTRQFA
NQSRFKRSGRGGLPINPHSALSSLAVWQDLRTDPEPLSQVSPASDLTATLPTDTPVQEIT
EAQGWQQDEQGRTVLTTQRQGPSHYAFQPSAPNC
Download sequence
Identical sequences B0CDW8
gi|158337462|ref|YP_001518637.1| 329726.AM1_4342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]