SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158337477|ref|YP_001518652.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337477|ref|YP_001518652.1|
Domain Number 1 Region: 64-252
Classification Level Classification E-value
Superfamily Pseudouridine synthase 9.18e-42
Family Pseudouridine synthase RsuA/RluD 0.00017
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00000000000000148
Family Ribosomal protein S4 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158337477|ref|YP_001518652.1|
Sequence length 269
Comment pseudouridine synthase family 1 protein [Acaryochloris marina MBIC11017]
Sequence
MEIRLQKLLSQWGVASRRQAEQLILAGQVQLNGHTAELGQKADPDQDQITLNGQILNPTD
RPQPLYLLVNKPKGVVSTCQDPQHRRTVLELLPKTYQQGQGLHPVGRLDVASTGALLLTN
DGQLTFALTHPRFHIAKTYQVWIEGCPPPEILDRWRQGIHLDGRTTLPAQVEILKPYQSH
TNSICLEVILQEGRNRQIRRIAEQLGYPVRKLHRTQIGSISLHSPSGKLLPQGRYRSLTA
SEMKNLRRLIKVRSSISPRRSSPYESARS
Download sequence
Identical sequences B0CDY3
gi|158337477|ref|YP_001518652.1| 329726.AM1_4356 WP_012164661.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]