SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158337481|ref|YP_001518656.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337481|ref|YP_001518656.1|
Domain Number 1 Region: 40-284
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.12e-80
Family Tryptophan biosynthesis enzymes 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158337481|ref|YP_001518656.1|
Sequence length 303
Comment indole-3-glycerol phosphate synthase [Acaryochloris marina MBIC11017]
Sequence
MQIRRRPPSVAVNVQELQYQVKTPENEPRNILEKIVWFKETEVEQMRDSVSLLDLRKQVA
NCEPPLSFLDALKHGKTQPALIAEVKKASPSKGVLRENFDPVAIAQAYEAAGASCLSVLT
DAEFFQGSFDYLQQIRAAVSLPLLCKEFVIYPYQIYLARSRGADAVLLIAAILSDQDLTY
FLKIIKSLGMTALVEVHTLPELERVMDIPGIELIGINNRDLETFTVDLEVTCQLLAQQGT
SLQDQDILVVSESGLHTSADLAQVKQAGAGAVLIGESLVKETGNASTHSETEQMQAKISA
LFS
Download sequence
Identical sequences B0CEU2
WP_012164664.1.67183 gi|158337481|ref|YP_001518656.1| 329726.AM1_4360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]