SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158337543|ref|YP_001518718.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337543|ref|YP_001518718.1|
Domain Number 1 Region: 9-108
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.82e-22
Family YeaZ-like 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|158337543|ref|YP_001518718.1|
Domain Number - Region: 120-211
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.00181
Family YeaZ-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158337543|ref|YP_001518718.1|
Sequence length 221
Comment glycoprotease family protein [Acaryochloris marina MBIC11017]
Sequence
MIIITKFQMHVLGLDTTSSALTLGISNFAQINRYQTWDLGRDISIHLHDYLKDFLAPLSW
SDLGWLVVAQGPGSFTGTRIGVVTARTLAQQLNIPLYGVSTLTAQAYAYASSLSKVHEDE
LIAVEYPGQRGSVYGSLFTWDASTQALSTYKPLQYVELEVWQHLLSTEKIHHHLYPDTVD
PQGICQAMISLAHQRWQAGQQPTWQEILPYYGSLAASPPSR
Download sequence
Identical sequences B0CF04
329726.AM1_4424 gi|158337543|ref|YP_001518718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]