SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158337594|ref|YP_001518769.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158337594|ref|YP_001518769.1|
Domain Number 1 Region: 11-385
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.3e-112
Family GABA-aminotransferase-like 0.000000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158337594|ref|YP_001518769.1|
Sequence length 391
Comment aminotransferase [Acaryochloris marina MBIC11017]
Sequence
MPRSKDQFLVFGSPAIEEAEMQEVMASMRTGWLGTGPKVMRFEQDFCTYKGSQHAIAVNS
CTAALHLSLLAAGLNPGDEVITTPLTFCATANAIIHAGGVPVLADVDPETMNIDPAQVEA
KITDRTKAIIPVHFAGRPCEMDALCALAEQYSLVLIEDCAHAIETEYQGRKAGTFSNFGC
FSFYVTKNITTGEGGMILTQTQEDTDRIKVLALHGMSQDAWKRFSDDGYNHYQVVEAGFK
YNMMDIQAAIGIHQLQRVTPYWNRRQQIWQQYNQALADLPLTLPTPPAPNTVHGYHLYTL
LIDESQTGISRDQFLVAMHRQHIGTGVHYLSLPEHPYYQHRFGWQPQDYPHATRIGQQTV
SIPLSAKLNDLDVEDVVAAVHQSLDTSAIAA
Download sequence
Identical sequences B0CG05
gi|158337594|ref|YP_001518769.1| 329726.AM1_4475 WP_012164767.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]