SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158337744|ref|YP_001518920.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158337744|ref|YP_001518920.1|
Domain Number - Region: 22-54
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0306
Family PhnA zinc-binding domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158337744|ref|YP_001518920.1|
Sequence length 61
Comment hypothetical protein AM1_4628 [Acaryochloris marina MBIC11017]
Sequence
MPPSLSYMLSQLSYMEQVRLIMTHPFFTGQCPECKTNIHITERAIGNCHCPVCNWTDRRD
S
Download sequence
Identical sequences B0C0B0
329726.AM1_4628 gi|158337744|ref|YP_001518920.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]