SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158338078|ref|YP_001519254.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338078|ref|YP_001519254.1|
Domain Number 1 Region: 33-367
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.67e-36
Family Filamentous hemagglutinin FhaB, secretion domain 0.0066
Further Details:      
 
Domain Number 2 Region: 379-499
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000973
Family Filamentous hemagglutinin FhaB, secretion domain 0.044
Further Details:      
 
Domain Number 3 Region: 623-711
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000628
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Domain Number 4 Region: 508-623
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000785
Family Filamentous hemagglutinin FhaB, secretion domain 0.054
Further Details:      
 
Weak hits

Sequence:  gi|158338078|ref|YP_001519254.1|
Domain Number - Region: 710-807
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00201
Family Filamentous hemagglutinin FhaB, secretion domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158338078|ref|YP_001519254.1|
Sequence length 963
Comment hemagglutination activity domain-containing protein [Acaryochloris marina MBIC11017]
Sequence
MTQHILRSYVQLGSASLFIGWTIFSIDVRHAIAQALPDASLGAERSIVTPNVNVNNRPAS
LIQGGAVRNSTTVFHSFERFDIPKNQAIFFDNPSAIRTIISRVTGNNPSQILGTLGLWNN
IAGTVGNADLFFINPRGIAFGPQSSLDLNGSFLASTATSINFGKEYQFSTINPAPPPILT
VNIPTGLQFSGSEAAILSQANVNPVNQTFGLNVPPDRTLALVGGNIIVQEGRLLAPQGRI
ELGSVKNGEVGLLPQFNSWKLDYSNIENFQDILLEQRSVVSATGVGGGEIRLQGRNVLIN
NNSRIFATVNFGFTLGGTLEIDASEIFQISNGSGVFTSTLADGDAGSILVKANKVLLKND
AAIVTNSAFIDFDFFQIRANGNSGNIYIDAPESVEIINNSQISTTTNTPGDAGLISIKTG
RLIASESSLFPAINSVADIGSEGEAGDINLLATRFIQIDNSSVSTFTAGLGDAGDLTINT
PKLLLANGGRLEASTFGSGKGGDIAAFVSDQINISGNTPNADQPSGIFSIVEVGATGSGG
QLLLNTGQLSIEKGGQVSTSTAGPGVAGKIDIRALQGVSLADPGSGVFANTTATGQGGTI
SFDTPNFLIEKGAVVNASTSGNGRGGSIFVQANRFTARQGGQLLSTASGQGPAGDITLQV
RDNITLTGANSGLFASTTPDSTGAAGNIFIDPIQVLIANGAAVSATSLGMGEGGDIQLRA
RNLTLDQGQITAEAAVAPAGDIQLNIDNFLLLRNGSLISTTAGGDATGGDINIDAQLVAA
FPFENSDITANALSGPGGNITITTQGVFGLEVRNTLTNASDITAFSQTNPQLNGIVEIIT
PEVDPSENLSEQPETVEKPTEIARGCKAQTASSSFVSKGRGGLPQNPDAALSGEAIWQDL
RAQEIQPAQQPINQTLPQSTSQTFLSSTSQWVEAKAWQRLSNGKVKLVGNSINQNTLHPV
PTC
Download sequence
Identical sequences B0C4Q3
329726.AM1_4965 gi|158338078|ref|YP_001519254.1| WP_012165209.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]