SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158338081|ref|YP_001519257.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338081|ref|YP_001519257.1|
Domain Number 1 Region: 67-353
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.02e-30
Family Filamentous hemagglutinin FhaB, secretion domain 0.012
Further Details:      
 
Domain Number 2 Region: 641-689,722-749
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000879
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 
Weak hits

Sequence:  gi|158338081|ref|YP_001519257.1|
Domain Number - Region: 361-449
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000345
Family Filamentous hemagglutinin FhaB, secretion domain 0.044
Further Details:      
 
Domain Number - Region: 460-560
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000377
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 
Domain Number - Region: 752-861
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000565
Family P22 tailspike protein 0.08
Further Details:      
 
Domain Number - Region: 569-640
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0408
Family P22 tailspike protein 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158338081|ref|YP_001519257.1|
Sequence length 998
Comment hemagglutination activity domain-containing protein [Acaryochloris marina MBIC11017]
Sequence
MRLILRKVSENLEALFSLRNVVIASIATSTFSFGLLHDIGLGEAQSISIDGSTPTNLTNC
IDNCTISGGSLRGNNLFHSFSDFGVNSGSVATFIDPGVVNIFSRITGANKSNIDGLIRVS
GGNGNLYILNPNGFVFGKNASLDLSGSFIASSANSVQFGNQGFLNIATNQISNLTINPSA
LIYDQAGKAINVNGAQLTVNDNQNLLLLGGEVNISNGASLGAFGGRIEIGGLDKPGAIRL
NPNRGFSLQYVNGTSLSNISISDALLDVAAGNSIGGGSLRISANNINIENSNFFAGLLFL
GESETRSGDIEFSATNDIKIINSSIENRLFENNQGFSGDIIINANNLLLDSSSVKADLDS
GAQGSSGEIRIKTNSLNLSNQSLVSTNIFGIGNSEGISIFSNGGIFIESSSILSNLENNS
QGVGGKISIQSKEISLSNQSLISTNLFGEGAVGNIGIVVDRASLNSSSIVSDVAQNGKGN
GGEIFITVHDLSLVNNSFIGSSTFGEGNTGKISILAEDKVNLETSFILSNISAGGKGNSR
TISVDTSKLILSNGAQIGSNVSASSNLFPGGNGKGGNIEIFASEIVHIFGVSKLVGPFEG
FSSGLFTTTDEGAIGPAGKITVTTDIFRITDGASVSAQTFNASTGGDITINARIFEALRG
GQLVTTTSSIGDAGNIRLNVSESILLSGDDPTFFVRKAKFPDIVQNEGSASGLFATSRPN
STGKAGSIIIDPQSFFISNGAQIAVNSQGNSPAGNVNLQAGNLTLDKGKILATSTSGQGG
DINLDIDNFLFLTNGSQISATAGNQNTSGDGGNVTINTELLVALNNSDITANAFTGKGGN
IQITTRGLFQSPDSNITASSESGVNGQVIINNPEVDPSESLSELPESVEPPQDIAKGCRP
GQTLGDSNFVHVGRGGLPPGPHEAQTPSTVWKDLRANNLQPSYTTTVDTSPTPSAPEISK
VGPDIVEAKGWSKDSQGRIYLTANVPQPVNSPQPIATC
Download sequence
Identical sequences B0C4Q6
329726.AM1_4968 WP_012165212.1.67183 gi|158338081|ref|YP_001519257.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]