SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158338244|ref|YP_001519421.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338244|ref|YP_001519421.1|
Domain Number 1 Region: 16-150
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-35
Family cAMP-binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 155-232
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.46e-17
Family CAP C-terminal domain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158338244|ref|YP_001519421.1|
Sequence length 233
Comment Crp/FNR family transcriptional regulator [Acaryochloris marina MBIC11017]
Sequence
MDDRHSSRDDKLETQLRSTPFFAGLPDPVVDQAVAQVVTREHPANRVILLENDWGSSVYF
ILNGWVKIRTYNIDGKEVTLNIVGKGEIFGEMAPLDEVPRSTDVITLTPTTVANMPSTDF
VNLMQTQPQAGIRLAKLMARRLRQLNRRLRLREADAQSRVADILLFLAEGQGIEGKGGIE
IPNLPHRELSSLSGMARETVTRQLGKLENKGLIQRNQDVLCIIDTDALEDLIL
Download sequence
Identical sequences B0C8E7
gi|158338244|ref|YP_001519421.1| WP_012165365.1.67183 329726.AM1_5140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]