SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158338274|ref|YP_001519451.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338274|ref|YP_001519451.1|
Domain Number 1 Region: 245-408
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.45e-44
Family Histidine kinase 0.0012
Further Details:      
 
Domain Number 2 Region: 37-150
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.25e-24
Family Flavin-binding PAS domain 0.071
Further Details:      
 
Domain Number 3 Region: 174-257
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 4.51e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158338274|ref|YP_001519451.1|
Sequence length 410
Comment two-component sensor histidine kinase [Acaryochloris marina MBIC11017]
Sequence
MSQPHNQSLLTSPLSNEPPPRDLALEILWQHHQLILDAIGEGVYGLDIEGNVTFVNPAAA
KMIGWSTAELIGQPMHAVLHHSHPNGSHYPKENCPIYAAFRDGKVYRVTDEVFWRRDGTC
FPVEYISTPIHDEQGQIVGAVVTFCDITQRQWAESVLKQTNEVLESKVRERTAELEQVNQ
QLQELSALKSRFVAMVCHEFRNPLNNIALSISSLNRYHSRLTVRQQSEYLAGIAENVERM
TEMIDDILVIGKLDAKRMELKSAEVDLVAFCQDLVAEVQSMAPHHVVLLICRHRQLITPI
DVQLLRSILTNILHNAIRYSPEDGEIQFKVSRRKHIITFQISDQGMGVSPEEQSLIFDPF
YRGKNVSNVPGTGLGLSIVKQFVELLQGTITLDSRIGVGTTFTVRLPCSR
Download sequence
Identical sequences B0C8H7
gi|158338274|ref|YP_001519451.1| WP_012165394.1.67183 329726.AM1_5170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]