SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158338535|ref|YP_001519712.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338535|ref|YP_001519712.1|
Domain Number 1 Region: 513-619,647-679
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000534
Family HD domain 0.03
Further Details:      
 
Weak hits

Sequence:  gi|158338535|ref|YP_001519712.1|
Domain Number - Region: 69-136
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 0.016
Family Chemotaxis protein CheA P1 domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158338535|ref|YP_001519712.1|
Sequence length 740
Comment metal dependent phosphohydrolase [Acaryochloris marina MBIC11017]
Sequence
MFVVSVAALTSVIGHRFYNEPQLTIGTVAPETIKAPESAQAADPIATAAAREAAFRNAVS
VYMVNPSQTAAIQADLDSYLADIQKFRGSAGEFPYTSIKTLSPRVQHFLRQQNTGDFQTL
LKQVNATTPPSTAWLKTKNAQAAIKALRTYRAKEKDGVKWSALMRSITQAQQDYQAALGK
VPPRLQGFSSRTLLEFTEPEWAMAQKRLRTALKRILTQGIPPGLPGTVMRSTIKVQLQDY
PAKVQALGIKLLPNVLKPNLSIDPTGTLRQREIIAEQIPPILIPIDKDEVIVKSGERISQ
ADFALLEHFGLSRRGINLLGLFGTMAAVSGGIAVFLVVQRRCRLEFDRRDYVLVLMLSAS
ASLLIWTTALRYTSLPAVGLLVGSFYGPVLGATVVVILSSLISLGLSSGFIELGAIAAGS
LVASLVARQRRSREEIALLGVIVAITQGVALFILMTLAGAPVYSILGLSLIQGLVGLGWT
IVALGISPYIEHVFDLVTPIRLAELANPNRPLLKRLSREAPGTFQHTMFVATLAEAGASA
LDCNVELVRTGTLYHDIGKMHDPQFFIENQRDTTNKHDLLNDPWQSAEIIKKHVSEGLVM
ARKCRLPAAVQAFIPEHQGTMVIAFFHHQAQQQASANPELDPVQESDFRYPGPVPQSRET
GIVMLADSCEAALRSLKDATPDLALKTINKIFKARWQDNQLVDSQLTRDELNVLAEVFVE
VWMQFHHKRIPYPTATIPPK
Download sequence
Identical sequences B0CCV1
gi|158338535|ref|YP_001519712.1| WP_012165632.1.67183 329726.AM1_5437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]