SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158338617|ref|YP_001519794.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338617|ref|YP_001519794.1|
Domain Number 1 Region: 10-338
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.36e-117
Family TK-like PP module 0.000000000581
Further Details:      
 
Domain Number 2 Region: 341-531
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.26e-66
Family TK-like Pyr module 0.00000031
Further Details:      
 
Domain Number 3 Region: 536-667
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.67e-42
Family Transketolase C-terminal domain-like 0.0000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158338617|ref|YP_001519794.1|
Sequence length 668
Comment transketolase [Acaryochloris marina MBIC11017]
Sequence
MVVATQSLDELCINAIRFLAIDAVEKAKSGHPGLPMGAAPMAYVLWDRIMRFNPKNPYWF
NRDRFVLSAGHGCMLQYALLHLTGFNSVSLEEIKNFRQWGSKTPGHPENFETPGVEVTTG
PLGQGICNAVGLAMAEAHLAAKFNKPEHTLVDHYSYVILGDGCNMEGVSGEACSLAGHLG
LGKLIALYDDNHISIDGSTDISFTEDVGKRFEAYGWHVQHVENGNTDLDGIQKAIEAAKV
VTDKPSLIKVTTTIGYGSPNKADTAGVHGAALGDAEIKATRENLGWSHEPFDIPDDVLSH
FRQAVDRGATAESEWDAVLASYRSQYPAEAAEFERMLKGELPADWDKALPRYTPADKGLA
TRKHSEITINALAGAIPEMIGGSADLTHSNLTEIKGSGNFQKGDYNNRNLRFGVREHGMG
AICNGIALHNSGLIPYCATFLVFADYMRAAIRLSALAEAGVIYVMTHDSIGLGEDGPTHQ
PVETIASLRAIPNLTVIRPADGNEVSGAYKVAIASRKYPTLIAFTRQALPNLAGSSIDAV
AKGAYIMSDSDGTPDMIMIATGSEVHLCEQAAEQLRSEGKKVRVVSMPSWELFEAQTPEY
KESVLPKAITKRLAVEAAADFGWHRYIGFEGQSISINRFGASAPGNTCLEQFGFTVENVL
AKAKDLMS
Download sequence
Identical sequences B0CE01
gi|158338617|ref|YP_001519794.1| 329726.AM1_5521 WP_012165705.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]