SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158338650|ref|YP_001519827.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338650|ref|YP_001519827.1|
Domain Number 1 Region: 13-137
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-24
Family cAMP-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158338650|ref|YP_001519827.1|
Sequence length 165
Comment cyclic nucleotide-binding domain-containing protein [Acaryochloris marina MBIC11017]
Sequence
MFSQTSSTVVNRLAFLRTTDFLQHIENEAFLECLAADMEERTFEENQAILHKGDRERLIF
FIVEGKVKIHVDDIKMAELSRGAHFGDINLFDSQPASATITTIEASKCLVLHQSKLQAAL
QKHAESKAELVASLYQRQQKAQTSTFQQNALQNWCTRIQNPSWAY
Download sequence
Identical sequences B0CE34
WP_012165732.1.67183 329726.AM1_5554 gi|158338650|ref|YP_001519827.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]