SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158338735|ref|YP_001519912.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338735|ref|YP_001519912.1|
Domain Number 1 Region: 35-359
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.08e-37
Family Filamentous hemagglutinin FhaB, secretion domain 0.017
Further Details:      
 
Domain Number 2 Region: 1366-1569
Classification Level Classification E-value
Superfamily TPR-like 3.41e-19
Family Tetratricopeptide repeat (TPR) 0.0068
Further Details:      
 
Domain Number 3 Region: 469-656
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000691
Family Filamentous hemagglutinin FhaB, secretion domain 0.069
Further Details:      
 
Domain Number 4 Region: 704-886
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000832
Family Filamentous hemagglutinin FhaB, secretion domain 0.06
Further Details:      
 
Domain Number 5 Region: 1488-1524,1595-1673
Classification Level Classification E-value
Superfamily TPR-like 0.0000000101
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 
Domain Number 6 Region: 891-1031
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000455
Family Virulence factor P.69 pertactin 0.064
Further Details:      
 
Domain Number 7 Region: 1289-1407
Classification Level Classification E-value
Superfamily TPR-like 0.000000948
Family Tetratricopeptide repeat (TPR) 0.0092
Further Details:      
 
Weak hits

Sequence:  gi|158338735|ref|YP_001519912.1|
Domain Number - Region: 394-466,496-515
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000596
Family P22 tailspike protein 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158338735|ref|YP_001519912.1|
Sequence length 2092
Comment hypothetical protein AM1_5643 [Acaryochloris marina MBIC11017]
Sequence
MKRIGCDRILIQHWVRPAIAPLMGVILSPLMFSKMVLAQLIVPDNTLGPEQSVVAPGATA
DEFFIDGGAQRNTALFHSFERFGINPNQTVFFSNPAIVENIFTRVTGGTASNINGLLGVD
GPANLFFVNPSGILFGPNAQLDVAGAFVATTADRFLLPNGNSFNAVNPNAPPLLTVSVPL
GVQFGATPQPISVNGSTLETAVGEPFALLGGQVNLNGAEILAPGGRVGLSGLSQPDTLLF
DLEAATPDTFLTVPVGGRSNLTLTNSTIDTVEEGGGDIVFEAGNTSLNQTNLFVGLNADV
ADVNAQGGSVLLNGTGDIQLIDSTVRSLVEDLGQGETVRISGQNLTLQDNSQILTSTLGD
SSSGDIRIDLTNRLRLERGSEIVSQSSADGFMSDAGSILINAPDIRLSFSSGISSESAGS
GGDIRITTNSLWVREESGISTRKLGPNTSEGDIRIQANSILVDDRGGPTLDRSPIGITTS
VTFFPEDLGLPPETLGGTGGNIEIDTQNLTLIGGLIAPVVFGNAQGGDLTIRAGDTVQLI
GDPAAARTDFAGVAELSTAIRDSTTEGFSGDIRINARHLILRDGSIIDAGAEGLGNSGDI
FINTTESVTLQGTLNGQPSRILTQLQNPGLFEGGNIDLVTGRLTIQDGGQISTSTTTNSI
GNGGDISVVANQSVLITGSSPRVTLPAADADSPFVLDSTNTLFPSGIFATAPGDGNAGGI
EVVSPNITLRNGAQLSVSSRNDGSAGNLFVRSNRFVLDDAALLAEAVEGNQADIGLIVRD
SLQILNGSRISTLAGGNADGGNIELTTGQLTIRDGGQITASTTADSVGNGGIVRVNANQG
ISITGSMPSPTGIFTSSLGEGDAGDVEIVTPTLMVSNGAQVSVSSSAGAAGFLSIDANKV
TLDNSALLAEAADGNLADIRLSIRDSLQLLKGSRISTVAGGNADGGNIELTTGQLTLRDG
SQILASTTADSVGNGGVVQVNANQGILITGSSPVPSGIFASSLGEGDAGDVEIVTPALMV
SNGAQISVSSAMGAAGLLFIDANTVVLDNAGLLAEAVEGNLANIELSVRDSLQLLNGSRI
STVASGDADGGNIFIGGTDTQLLRFLTLQGGSIISAENSGGFGDGGSIDISAQFIIAFPS
ELNRIIANAFEGDGGDIDIFTNAIFGPQFLNISASSQLGLNGEINIETIATDPASALSQL
PENVLDSSTRIADACAVPRTGQSQFVVTGRGGLPLMPSSRPAGSYLLVDLGTQALPEVTP
ALQEAKQLVVTARGDYYLQGESSRTLPKLLEEGRQAYQQANYADAVVHWTQAATQLSKHP
DAYASVQSHLALAYHYLGDWEQARSAIESSQRALTPDLIAEQPALQAQVLSARASLFLAR
GDTRSALEDWQAAANAYQRAGDDSGNLQVQLNQIQVLQDLGYLRQAQQQLVQLMQILEQQ
PPSPVKAMTQLNLGKVSRAEGNMLRSQRQIEAALNTAQSLNQPALTSTILLNLGHTFRGQ
GNTQKALDYYQQALGIAPTPLIQFQVQVSRFDLLVAQKNPATSELLQELQEQTGSLPSSR
EGIYAQLHLIETVLTAAKKDESSTLLDLLNRAQSQAQGLDDPNAQSYILGYQGRIYGEAQ
QWSQAVSLTEQALQHVHRQQSPEVLYQLAWQLGRYRRQLGNRQGAISAYLDAVAALDSLR
GDLKTASDDVRFTFRDGVEPVYRELVGLLLEGDMTQADSSSNLRRARKLIENLQLNEIRD
YFQDACVQAEPREVDQVDPNAAVIYPIVLEDRVDVIISIGDQPLRHYSTPIEPGQVDDTV
KQLLRSLTTPLGSVQKKNLTKLKQIYDWVVEPAAADLAQQDVETLVFVADGALRTLPLTM
LYDGEQYLIEQYNVALSPGLDLLAPRPQAREKVKLLVGGVSEARSGFPALPYVAKEVEQI
TSQIQEHAVLFNQDLTQQNLKDYLTEVSSEVVHLATHAEFGASPEDTFILTWEGRLSIQA
MASLLRTRIRTSEVPIDLLVLSACETATGNSRAVLGIAGMAIRSGVRSTLAGLWALDDQA
AAAFMGHFYKALAQPHTTKAAAFRQAQLALMKDPQFKAPYFWSPFVLVGNWL
Download sequence
Identical sequences B0CF77
WP_012165813.1.67183 329726.AM1_5643 gi|158338735|ref|YP_001519912.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]