SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158338877|ref|YP_001520054.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338877|ref|YP_001520054.1|
Domain Number 1 Region: 1-253
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.79e-83
Family Histidine biosynthesis enzymes 0.000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158338877|ref|YP_001520054.1|
Sequence length 255
Comment imidazole glycerol phosphate synthase subunit HisF [Acaryochloris marina MBIC11017]
Sequence
MLAKRILPCLDVKAGRVVKGVNFVNLKDAGDPVELAQIYNEAGADELVFLDITATHEDRN
IIFDVVYRTAEAVFIPLTVGGGIQSLETIKKLLRAGADKVSLNSFAVRNPDFVNQASERF
GRQCIVVAIDARRRDDGNSGWDVFVRGGRDNTGLDAISWAKEMEERGAGELLVTSMDGDG
TQAGYDLELTRTIAEQVEIPVIASGGAGTCDHIREALTDGKAEAALLASLLHYGQLSIAE
IKTHLQDHRVPIRLA
Download sequence
Identical sequences B0BZJ0
gi|158338877|ref|YP_001520054.1| 329726.AM1_5790 WP_012165949.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]