SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158339047|ref|YP_001520224.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339047|ref|YP_001520224.1|
Domain Number 1 Region: 3-325
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.2e-42
Family Filamentous hemagglutinin FhaB, secretion domain 0.011
Further Details:      
 
Domain Number 2 Region: 515-616,657-683
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000534
Family iota-carrageenase 0.072
Further Details:      
 
Domain Number 3 Region: 422-569
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000722
Family P22 tailspike protein 0.087
Further Details:      
 
Domain Number 4 Region: 329-449
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000135
Family Filamentous hemagglutinin FhaB, secretion domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158339047|ref|YP_001520224.1|
Sequence length 922
Comment hypothetical protein AM1_5969 [Acaryochloris marina MBIC11017]
Sequence
MPWGCLCHAQVVSDNTLTIPTVVSTSDAQNFIVSGGVIVNQKNIFHSFRNFSIPKNGSVI
FKNLSVENIISRVTGSNPSYIDGLITANANLFLVNPKGIFFGQGSQLNIDGSFVASTANQ
INFEDGHFFSTHTNEAPILTMSMPTGLQLGKDASSIGITGDFLDPFLSVQPGKSLVLIGN
GLFLQGGALAAPSGRIELASVDDFSVVGLKKASEGFTLNFDPVKNFQIIRLSKGAFIDTS
DFFAGPIRIYGKDISLVDRSAITAFNFIDDLPGASINVQATESFKLSNQSSISVGDGNNG
KISISAKRLSLSDFSIIDASTIFLGTKGSIIIRASEYVLIDKGSAISAFTTGNDAGEISI
HTGQLILRDGGQIDSTTFFGAKGNAGNLLIEATESIDIFGQITTSNGLTFVSNLFVGTAG
SGTTGNGGNINLKTKRLSVTNSGTISVASLRGSLGQAGTLSIDASDYVLIDGQDTVISAE
SSSPLPAGDITINTGSFRIQNGATISASTTGPGTAGTIQIKSGSFSASGPSSGVFTTTTS
SGAGGDIIIDTQLFKLFDRAVIDARTTDSGIGGNIFVQANLLEISSGGQLVTTTSGPSAA
GNISLQVLDSIVLEGRDSGLFANTDPGSNGPGGNIFVDPPIVIIRDNAGIRVDSQGTGPG
GNIDLLAGNLTLQNGGFISAETTSGQGGNIGLRISDVLQLQNQSRISATAGRNGEIGDGG
NINIFAQFIVANPFENNDITANAFTGTGGNISIQTEAIFGFQVVDDLTPFSDISASSQLG
LSGTVSIDTPETDPTEGLVDLPAAVVDPSSLVSQACIGHSGELASEISEFTVTGRGGVPA
NPTETLRQNSTLTEWIAPEGQNTSATKPSSRVETSQVTDSPHLIIEAQGWKTNKQGQLVL
TAEPQPPLAHIAGLTQARCPKT
Download sequence
Identical sequences B0C2L7
329726.AM1_5969 gi|158339047|ref|YP_001520224.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]