SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158339157|ref|YP_001520334.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339157|ref|YP_001520334.1|
Domain Number 1 Region: 32-216,340-432
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.14e-34
Family HI0933 N-terminal domain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158339157|ref|YP_001520334.1|
Sequence length 678
Comment halogenase [Acaryochloris marina MBIC11017]
Sequence
MKPLNASPPISQPINSTTAQKNAGHRLPVGRIDVAIIGSGIAGSTLGAILARQGLKVILF
EAGSHPKFAIGESMILETSEMMRSLSERYDIPELAYFSSENYFERIGTSHGVKRHFSFAH
HSEGQPFDQQRTLQAVIPKQPYGHELHLYRQDTDYFLMTVAIRYGAQVMQNTPVQSVEIN
EVGVALLTQSGEQFEADYIVDAGGFRSLLAEQFDLRHHNLQTHSRAIFTHMVDVPCFHEV
TAPKETYQLPFQLSEGTLHHVFKGGWLWVIPFDNHAKSTNPLCSVGLMLDPRVYPAQPEL
SPEVEFFQFIERFPSIAEQFRQAKAVRNWTRTGRIQYSAKQVVGDRFCLLGQAAGFIDPL
FSKGLYTALACTSALAERLLTAKETGDYSAAYFRSVEALTLAYIQANDQLVTHAYQSFSD
YRLWSPFSVLWLTGAYLELVKLTSSRALAINRQEYDQQLQTLRLAGGGFPEFEQLAQHIY
TLVDRTTLSRDIPKLAQQMTQQLEQASWMPQVFKAVLNGKNHLPSNKLHPRLLRSKKGFM
GTGQYQTHFFGDRTLPFFLSFYLRERIKYSQRLLQFKRDLKLWNRGLLHPVRWSAAVSRV
MPLTLATLVTTYLSIPQSYRFSIENRSDHSLINVLANPTQFQLNCSSFVSDVVDVRMSGD
LPTFAIKTPCNIQSTNNQ
Download sequence
Identical sequences B0C3S8
329726.AM1_6083 gi|158339157|ref|YP_001520334.1| WP_012166211.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]