SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158339323|ref|YP_001520500.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158339323|ref|YP_001520500.1|
Domain Number - Region: 36-90
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 0.0288
Family Prokaryotic type I DNA topoisomerase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158339323|ref|YP_001520500.1|
Sequence length 519
Comment hypothetical protein AM1_6249 [Acaryochloris marina MBIC11017]
Sequence
MKFLNNIFNTLLCRLTSIVLIGLLNLLGVQIQPVVAGPNNSPCTSSNPQLAQPWCIPTTL
TLSSTDADQEQYEYYDFIWRTFIALNWPNVPITVEGNQIVEGFRGEPDPTINILDQQGNG
PLKQSVWENYREPSSEIFLPPEDWDNYPEWNTPRPPVADRPNNQRFLKNFDGLVEYAADI
NQPYFYPNLTGPLIDQAGNFVRYEVATNQAFFTYIQHSRYYDTQQQKEDVARSIEKPKDK
QSGFKRPPYGDEAYLRNLKPFAKQGFIDVKAAWRELKEDDPLERYLHRTLVVDHQGTQKM
MGLVALHVFRYTLIDQNGKITPGYVGATFEQVDNVESSPGIKPSFNTGSKPSEVQKTFGF
SGDIPTTASKDNPKPQSPVSIYRVTPIPGSDVFCPPPNQTQKCPPALSVAAINAKYQEQL
QPSVFSYYQLIGTQNKRPDRPLDFSNPSNRQFNGHEGPITGVYTNTNNLINTALESYTQQ
NFSCILCHSQARPQGVPKKSFEDDRFKIITFMLNMAHDK
Download sequence
Identical sequences B0C664
WP_012166366.1.67183 gi|158339323|ref|YP_001520500.1| 329726.AM1_6249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]