SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158339497|ref|YP_001520886.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339497|ref|YP_001520886.1|
Domain Number 1 Region: 6-413
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.02e-97
Family GABA-aminotransferase-like 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158339497|ref|YP_001520886.1|
Sequence length 416
Comment diaminobutyrate--2-oxoglutarate aminotransferase [Acaryochloris marina MBIC11017]
Sequence
MNIFEQRESNVRSYCRSFPTVFHRAKGALVYSESGKENIDFLAGAGALNYGHNNDYIKQK
VLSYLDADAMTHGLDLHTAAKEKFLATFSEQVLIPKQLDYRIQCCGPTGTNAVEAALKLA
RKVKNRTGIFSFMGAYHGMTQGSLSVTGNTAIRSGIESFAQVTFMPYPYRLMDGFDTIHY
IESVLNDIHSGIEKPAAIIFETVQAEGGIVVAPIDWIQQLRALCDRNDILLICDDIQVGC
GRTGPFFSFERANIIPDMVILSKSISGYGFPMSLLLMKQELDQWQPGEHTGTFRGYQLAF
VGGTAALEYRSSTDLEKVVRLKETFLRTFLTEEIAPLHPKIEIRGLGLIWGIDLAALDDG
NFAKKIATRCFEQGLIIERVGRRDTVLKLLPPLTIEMPILRRGCTILKQAIEECLA
Download sequence
Identical sequences A8ZKN6
329726.AM1_A0234 WP_012166732.1.67183 gi|158339497|ref|YP_001520886.1| gi|158339497|ref|YP_001520886.1|NC_009926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]